PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM02G21270.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 349aa    MW: 37441.6 Da    PI: 5.7159
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM02G21270.4genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.6e-18152206256
                      T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
         Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      rk+ +++keq   Le+ F+++++++ +++ +LA++l+L  rqV vWFqNrRa+ k
  OGLUM02G21270.4 152 RKKLRLSKEQSSFLEDSFKEHSTLTPKQKSDLANRLNLRPRQVEVWFQNRRARTK 206
                      788899***********************************************98 PP

2HD-ZIP_I/II126.21.5e-40152243192
      HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                      +kk+rlskeq+++LE+sF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL++ev+eLr +l+
  OGLUM02G21270.4 152 RKKLRLSKEQSSFLEDSFKEHSTLTPKQKSDLANRLNLRPRQVEVWFQNRRARTKLKQTEVDCEHLKRCCERLTRENRRLQREVAELRGALR 243
                      69**************************************************************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.8E-18133206IPR009057Homeodomain-like
SuperFamilySSF466891.0E-17143209IPR009057Homeodomain-like
PROSITE profilePS5007117.135148208IPR001356Homeobox domain
SMARTSM003892.1E-16150212IPR001356Homeobox domain
CDDcd000863.85E-17152209No hitNo description
PfamPF000461.2E-15152206IPR001356Homeobox domain
PROSITE patternPS000270183206IPR017970Homeobox, conserved site
PfamPF021835.6E-11208242IPR003106Leucine zipper, homeobox-associated
SMARTSM003405.3E-19208252IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MELELSLGDS PAPVKATIAP TPVLTPTCMG DEEDLELVLG VRATRRDEQD DQTTCTQSSE  60
EAMEGEEDET RPHGEAPVES LSFPLFVSSA ETGSANSEMC TRGFDVNTRP ADGGAEAGRP  120
SSPSSMQEAS TRQQVADQEA ADDEDNGGGG ARKKLRLSKE QSSFLEDSFK EHSTLTPKQK  180
SDLANRLNLR PRQVEVWFQN RRARTKLKQT EVDCEHLKRC CERLTRENRR LQREVAELRG  240
ALRTTTSSYP PLYGLHHLPA AAGTVFRVCP SCEHSKVVAA AASESFSPRV FACGGAPAAI  300
TAAAAVPSPG AGSPPSSSAA LFGARRPHFG PFAAAVIPPV LRRQPSATS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1200208RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0641180.0AK064118.1 Oryza sativa Japonica Group cDNA clone:002-102-B08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015626174.10.0PREDICTED: homeobox-leucine zipper protein HOX7 isoform X1
SwissprotA2X6740.0HOX7_ORYSI; Homeobox-leucine zipper protein HOX7
TrEMBLA0A0D9YTU30.0A0A0D9YTU3_9ORYZ; Uncharacterized protein
STRINGBGIOSGA006230-PA0.0(Oryza sativa Indica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-52homeobox from Arabidopsis thaliana